Sermorelin 10mg

What is Sermorelin 10mg ?

Sermorelin 10mg is the larger vial of sermorelin, the 29-residue GHRH (1-29) amide. It holds twice the lyophilised peptide of the 5mg vial in the same single-vial format, under its own batch, UKPL-9503.

The compound is identical to the 5mg vial: same sequence, same receptor pharmacology, white lyophilised powder. Sermorelin is the shortest fragment of the 44-residue growth-hormone-releasing hormone with full biological activity. Its chemistry and the Geref diagnostic history (Prakash and Goa, BioDrugs, 1999) are covered on the main Sermorelin page.

Sermorelin 10mg Research Applications

The applications match the 5mg vial. Sermorelin is the reference GHRH (1-29) agonist in somatotroph signalling and GHRH receptor pharmacology, and the native comparator when CJC-1295, modified GRF (1-29) or tesamorelin is benchmarked. The 10mg size suits designs that use material quickly, such as dose-response plates, long time-course work and analytical method development. Running a whole design on one batch removes inter-batch variance.

Sermorelin 10mg vs 5mg

The molecule is the same, so the differences are handling and logistics. Each size is its own batch with its own certificate, so the 10mg figures are not inherited from the 5mg batch. At the same fill volume, the 10mg vial gives twice the concentration. One batch under one certificate covers twice the work, and the cost per milligram is lower. The trade-off is exposure. A larger vial is usually drawn from over a longer period, and methionine 27 oxidises with each re-entry. Splitting the stock into single-use aliquots at reconstitution solves that.

Research Overview

This page covers the 10mg presentation. The compound is the same 29-residue peptide amide supplied in the standard vial, GHRH (1-29), sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, molecular weight 3357.9 g/mol, CAS 86168-78-7, the shortest fragment of the native 44-residue growth-hormone-releasing hormone that retains full biological activity, and its pharmacology at the GHRH receptor on anterior pituitary somatotrophs, together with the Geref diagnostic history reviewed by Prakash and Goa (BioDrugs, 1999), is documented in full on the main Sermorelin page. What is specific to the 10mg vial is handling. Ten milligrams is twice the content of the 5mg vial in the same single-vial glass format, so at a fixed fill volume the reconstituted stock is twice as concentrated; fill volume must therefore be scaled to the target concentration rather than carried over from smaller-vial work, and the resulting concentration recorded against the batch. The more consequential point at this size is oxidative exposure across the vial's working life. The sequence carries a methionine at position 27, the oxidation-prone residue that dictates careful handling, and a vial holding twice the mass is typically accessed over a longer period and across more stopper penetrations, which increases cumulative headspace air exposure, light exposure and freeze-thaw opportunity on a single reconstituted stock. Aliquoting into single-use volumes immediately after reconstitution therefore matters more here than on a 5mg vial. The offsetting advantages are batch continuity under one certificate of analysis and a lower cost per milligram, since vial, stopper, lyophilisation and assay costs are incurred per vial rather than per milligram. Each vial contains 10mg of sermorelin as white lyophilised powder, batch UKPL-9503, verified at 99.38% purity by RP-HPLC, with the certificate of analysis published on this page. Supplied strictly for in-vitro laboratory research use only.

Storage and Reconstitution

Keep sealed vials at -20°C, away from light and moisture. After reconstitution, keep the solution at 2-8°C and use it within 4 weeks, or freeze single-use aliquots at -20°C. On a 10mg vial, aliquoting is the main defence against oxidation of methionine 27. Keep vials tightly sealed with little headspace and away from oxidising agents.

Vials are sold on their own, without bacteriostatic water for mixing or other supplies.

How to reconstitute and handle

Bring the vial and the bacteriostatic water to room temperature and swab both stoppers with alcohol. Add the water slowly down the inside wall, never onto the powder, and swirl gently until dissolved. Do not shake or vortex. The solution should be clear and colourless. Set the fill volume from your target concentration, then split the stock into single-use aliquots straight away. Label each with the date and refrigerate.

• Scale the bacteriostatic water fill volume to your target concentration. A 10mg vial reaches twice the concentration of a 5mg vial at the same fill volume, so a volume carried across from smaller-vial work will not reproduce the same stock.
• Aliquot into single-use volumes immediately after reconstitution and hold them at -20°C. This matters more on a 10mg vial than a 5mg one, because twice the mass in one vial means a longer working life and more accumulated stopper penetrations on a single stock.
• Minimise headspace air exposure and protect from light at every step. The methionine at position 27 is the oxidation-prone residue of the sequence, and a vial with a long in-use window accumulates more oxidative exposure than a small one.
• Do not leave dilute solution standing at room temperature. Return aliquots to cold storage promptly after each withdrawal rather than working from a stock left out across a session.
• Introduce the diluent slowly down the inner glass wall, never onto the lyophilised cake, and swirl gently until fully dissolved. Allow the vial to reach room temperature before opening.

For the full method, see the peptide reconstitution guide and the reconstitution calculator.

Research References

• Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency (Prakash and Goa, BioDrugs, 1999)
• Sermorelin: a better approach to management of adult-onset growth hormone insufficiency? (Walker, Clin Interv Aging, 2006)

Published research on Sermorelin is indexed on PubMed. See our full UK buyer's guide for Sermorelin and UK buyer's guide for Sermorelin 10mg.